PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00082502001
Common NameGSBRNA2T00082502001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 283aa    MW: 31459.6 Da    PI: 8.2237
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00082502001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.4e-171461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+eEde+lv+++++   g+W++ +++ g+ R++k+c++rw +yl
  GSBRNA2T00082502001 14 KGPWTPEEDEILVEYINKNSHGSWRLLPKKAGLLRCGKSCRLRWTNYL 61
                         79******************************99************97 PP

2Myb_DNA-binding51.81.8e-1667112148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg++T++E++l v++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
  GSBRNA2T00082502001  67 RGPFTPQEEKLVVQLHAILGNR-WAAIAAQLP-GRTDNEIKNLWNTHL 112
                          89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.308961IPR017930Myb domain
SuperFamilySSF466899.54E-3011108IPR009057Homeodomain-like
SMARTSM007173.5E-131363IPR001005SANT/Myb domain
PfamPF002495.7E-151461IPR001005SANT/Myb domain
CDDcd001673.07E-101661No hitNo description
PROSITE profilePS5129424.99562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2665116IPR009057Homeodomain-like
SMARTSM007178.8E-1566114IPR001005SANT/Myb domain
PfamPF002492.4E-1567112IPR001005SANT/Myb domain
CDDcd001674.81E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGRKPCCDKK GLKKGPWTPE EDEILVEYIN KNSHGSWRLL PKKAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF TPQEEKLVVQ LHAILGNRWA AIAAQLPGRT DNEIKNLWNT HLKKRMLSMG  120
LDPKTHEPLP SHGLAKQASA SQTTRHMAQW ESARLEAEAR LSRESMLFNP SCEVKYECDH  180
FLRIWNSEIG ESFKNLTTTS QSPCSRTTSS SSALVGKETV MGINHGSGSS SPCSNNVQDV  240
SSDSALQLLL DFPISDDDMS FLEENIGSSY TESHVGVSIN GF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591018.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A078I9840.0A0A078I984_BRANA; BnaCnng13680D protein
STRINGBra003443.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-149myb domain protein 17
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]